LL-37 Research Compound (LL37)

"Premium grade LL-37 validation."

LL-37 is the only human cathelicidin and a 37-amino-acid host-defense peptide with the sequence [LL-37, 37 aa] It is studied in microbiology and immunology research for its broad-spectrum antimicrobial, chemotactic, and immunomodulatory activities (Fabisiak et al., Pharmacol Rep 2016, PMID 27117377; Int J Mol Sci 2022, PMC9445486). LL-37 research peptide is supplied lyophilized at ≥99% purity verified by HPLC, with identity confirmed by mass spectrometry and a batch-specific Certificate of Analysis (COA) included. Store lyophilized powder at −20 °C, protected from light and moisture. For laboratory research use only — not for human or animal consumption.